LSM12B anticorps

N° du produit ABIN632732

Détail du produit anti-LSM12B anticorps

Antigène: LSM12B (LSM12 Homolog B (LSM12B))

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSM12B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSM12B

Antigène: LSM12B (LSM12 Homolog B (LSM12B))

Autre désignation: LSM12 (LSM12B Produits)

Synonymes: anticorps 1110032E16Rik, anticorps 1110059P07, anticorps 2600001B17Rik, anticorps RGD1309441, anticorps lsm12, anticorps lsm12a, anticorps wu:fe01f11, anticorps zgc:66039, anticorps LSM12, anticorps PNAS-135, anticorps LSM12 homolog, anticorps LSM12 homolog b, anticorps Lsm12, anticorps lsm12b, anticorps LSM12

Sujet: LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.

Poids moléculaire: 22 kDa (MW of target protein)