LSM12B anticorps
-
- Antigène Voir toutes LSM12B Anticorps
- LSM12B (LSM12 Homolog B (LSM12B))
-
Reactivité
- Souris, Rat, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LSM12B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL
- Top Product
- Discover our top product LSM12B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LSM12B (LSM12 Homolog B (LSM12B))
- Autre désignation
- LSM12 (LSM12B Produits)
- Sujet
- LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.
- Poids moléculaire
- 22 kDa (MW of target protein)
-