KRT222 anticorps (N-Term)

N° du produit ABIN632733

Détail du produit anti-KRT222 anticorps

Antigène: KRT222 (Keratin 222 (KRT222))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRT222 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222 P

Purification: Affinity purified

Immunogène: Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222 P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 222 Pseudogene Blocking Peptide, catalog no. 33R-2575, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 222 Pseudogene antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT220 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRT222

Antigène: KRT222 (Keratin 222 (KRT222))

Abstract: KRT222 Produits

Synonymes: anticorps KRT222P, anticorps KA21, anticorps 6330509G02Rik, anticorps keratin 222, anticorps KRT222, anticorps Krt222

Sujet: KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.

Poids moléculaire: 34 kDa (MW of target protein)