AMDHD1 anticorps (N-Term)
-
- Antigène Voir toutes AMDHD1 Anticorps
- AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AMDHD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AMDHD1 antibody was raised against the N terminal of AMDHD1
- Purification
- Affinity purified
- Immunogène
- AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV
- Top Product
- Discover our top product AMDHD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AMDHD1 Blocking Peptide, catalog no. 33R-1604, is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))
- Autre désignation
- AMDHD1 (AMDHD1 Produits)
- Synonymes
- anticorps RGD1308879, anticorps 1300019J08Rik, anticorps amidohydrolase domain containing 1, anticorps amidohydrolase domain containing 1 L homeolog, anticorps si:ch73-71d17.1, anticorps Amdhd1, anticorps AMDHD1, anticorps amdhd1, anticorps amdhd1.L, anticorps si:ch73-71d17.1
- Sujet
- The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 47 kDa (MW of target protein)
-