AMDHD1 anticorps (N-Term)

N° du produit ABIN632735

Détail du produit anti-AMDHD1 anticorps

Antigène: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMDHD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AMDHD1 antibody was raised against the N terminal of AMDHD1

Purification: Affinity purified

Immunogène: AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMDHD1 Blocking Peptide, catalog no. 33R-1604, is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMDHD1

Antigène: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Autre désignation: AMDHD1 (AMDHD1 Produits)

Synonymes: anticorps RGD1308879, anticorps 1300019J08Rik, anticorps amidohydrolase domain containing 1, anticorps amidohydrolase domain containing 1 L homeolog, anticorps si:ch73-71d17.1, anticorps Amdhd1, anticorps AMDHD1, anticorps amdhd1, anticorps amdhd1.L, anticorps si:ch73-71d17.1

Sujet: The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 47 kDa (MW of target protein)