FAM161B anticorps (Middle Region)

N° du produit ABIN632736

Détail du produit anti-FAM161B anticorps

Antigène: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM161B est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF44 antibody was raised against the middle region of C14 rf44

Purification: Affinity purified

Immunogène: C14 ORF44 antibody was raised using the middle region of C14 rf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM161B

Antigène: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Autre désignation: C14ORF44 (FAM161B Produits)

Synonymes: anticorps C14orf44, anticorps c14_5547, anticorps 9330169D17, anticorps 9830169C18Rik, anticorps RGD1309058, anticorps family with sequence similarity 161 member B, anticorps family with sequence similarity 161, member B, anticorps FAM161B, anticorps Fam161b

Sujet: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 74 kDa (MW of target protein)