FAM161B anticorps (Middle Region)
-
- Antigène Tous les produits FAM161B
- FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM161B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C14 ORF44 antibody was raised against the middle region of C14 rf44
- Purification
- Affinity purified
- Immunogène
- C14 ORF44 antibody was raised using the middle region of C14 rf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF44 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))
- Autre désignation
- C14ORF44 (FAM161B Produits)
- Synonymes
- anticorps C14orf44, anticorps c14_5547, anticorps 9330169D17, anticorps 9830169C18Rik, anticorps RGD1309058, anticorps family with sequence similarity 161 member B, anticorps family with sequence similarity 161, member B, anticorps FAM161B, anticorps Fam161b
- Sujet
- The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 74 kDa (MW of target protein)
-