FAM81A anticorps (N-Term)

N° du produit ABIN632737

Détail du produit anti-FAM81A anticorps

Antigène: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM81A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM81 A antibody was raised against the N terminal of FAM81

Purification: Affinity purified

Immunogène: FAM81 A antibody was raised using the N terminal of FAM81 corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM81A Blocking Peptide, catalog no. 33R-3209, is also available for use as a blocking control in assays to test for specificity of this FAM81A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM81A

Antigène: FAM81A (Family with Sequence Similarity 81, Member A (FAM81A))

Autre désignation: FAM81A (FAM81A Produits)

Synonymes: anticorps 6430514L14Rik, anticorps RGD1311958, anticorps family with sequence similarity 81, member A, anticorps family with sequence similarity 81 member A, anticorps Fam81a, anticorps FAM81A

Sujet: The function of FAM81 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)