C4ORF23 anticorps (N-Term)

N° du produit ABIN632740

Détail du produit anti-C4ORF23 anticorps

Antigène: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4ORF23 est non-conjugé

Application: Western Blotting (WB)

Specificité: C4 ORF23 antibody was raised against the N terminal Of C4 rf23

Purification: Affinity purified

Immunogène: C4 ORF23 antibody was raised using the N terminal Of C4 rf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4ORF23 Blocking Peptide, catalog no. 33R-5486, is also available for use as a blocking control in assays to test for specificity of this C4ORF23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4ORF23

Antigène: C4ORF23 (METTL19) (Methyltransferase Like 19 (METTL19))

Autre désignation: C4ORF23 (METTL19 Produits)

Synonymes: anticorps C4orf23, anticorps 2310079F23Rik, anticorps Mettl19, anticorps c4orf23, anticorps mettl19, anticorps METTL19, anticorps TRM44, anticorps tRNA methyltransferase 44 homolog (S. cerevisiae), anticorps tRNA methyltransferase 44, anticorps tRNA methyltransferase 44 homolog L homeolog, anticorps tRNA methyltransferase 44 homolog, anticorps TRMT44, anticorps Trmt44, anticorps trmt44.L

Sujet: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)