FAM81B anticorps (N-Term)

N° du produit ABIN632741

Détail du produit anti-FAM81B anticorps

Antigène: FAM81B (Family with Sequence Similarity 81, Member B (FAM81B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM81B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM81 B antibody was raised against the N terminal of FAM81

Purification: Affinity purified

Immunogène: FAM81 B antibody was raised using the N terminal of FAM81 corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM81B Blocking Peptide, catalog no. 33R-6333, is also available for use as a blocking control in assays to test for specificity of this FAM81B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM81B

Antigène: FAM81B (Family with Sequence Similarity 81, Member B (FAM81B))

Autre désignation: FAM81B (FAM81B Produits)

Synonymes: anticorps family with sequence similarity 81 member B, anticorps FAM81B

Sujet: The specific function of FAM81B is not yet known.

Poids moléculaire: 52 kDa (MW of target protein)