C12ORF50 anticorps (N-Term)

N° du produit ABIN632742

Détail du produit anti-C12ORF50 anticorps

Antigène: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12ORF50 est non-conjugé

Application: Western Blotting (WB)

Specificité: C12 ORF50 antibody was raised against the N terminal Of C12 rf50

Purification: Affinity purified

Immunogène: C12 ORF50 antibody was raised using the N terminal Of C12 rf50 corresponding to a region with amino acids INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF50 Blocking Peptide, catalog no. 33R-4072, is also available for use as a blocking control in assays to test for specificity of this C12ORF50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12ORF50

Antigène: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Autre désignation: C12ORF50 (C12ORF50 Produits)

Synonymes: anticorps C12orf50, anticorps MGC134438, anticorps chromosome 1 C12orf50 homolog, anticorps chromosome 12 open reading frame 50, anticorps chromosome 5 open reading frame, human C12orf50, anticorps C1H12orf50, anticorps C12orf50, anticorps C5H12orf50

Sujet: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 47 kDa (MW of target protein)