C12ORF50 anticorps (N-Term)
-
- Antigène Tous les produits C12ORF50
- C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C12ORF50 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C12 ORF50 antibody was raised against the N terminal Of C12 rf50
- Purification
- Affinity purified
- Immunogène
- C12 ORF50 antibody was raised using the N terminal Of C12 rf50 corresponding to a region with amino acids INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C12ORF50 Blocking Peptide, catalog no. 33R-4072, is also available for use as a blocking control in assays to test for specificity of this C12ORF50 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))
- Autre désignation
- C12ORF50 (C12ORF50 Produits)
- Synonymes
- anticorps C12orf50, anticorps MGC134438, anticorps chromosome 1 C12orf50 homolog, anticorps chromosome 12 open reading frame 50, anticorps chromosome 5 open reading frame, human C12orf50, anticorps C1H12orf50, anticorps C12orf50, anticorps C5H12orf50
- Sujet
- The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 47 kDa (MW of target protein)
-