NANP anticorps (Middle Region)

N° du produit ABIN632748

Détail du produit anti-NANP anticorps

Antigène: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NANP est non-conjugé

Application: Western Blotting (WB)

Specificité: NANP antibody was raised against the middle region of NANP

Purification: Affinity purified

Immunogène: NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NANP Blocking Peptide, catalog no. 33R-9755, is also available for use as a blocking control in assays to test for specificity of this NANP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NANP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NANP

Antigène: NANP (N-Acetylneuraminic Acid Phosphatase (NANP))

Autre désignation: NANP (NANP Produits)

Synonymes: anticorps rgd1306009, anticorps C20orf147, anticorps HDHD4, anticorps dJ694B14.3, anticorps 1600031M04Rik, anticorps Hdhd4, anticorps RGD1306009, anticorps zgc:111947, anticorps N-acylneuraminate-9-phosphatase, anticorps N-acetylneuraminic acid phosphatase, anticorps N-acetylneuraminic acid phosphatase L homeolog, anticorps nanp, anticorps NANP, anticorps Nanp, anticorps nanp.L

Sujet: The function of NANP protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 28 kDa (MW of target protein)