PDIK1L anticorps (Middle Region)
-
- Antigène Voir toutes PDIK1L Anticorps
- PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDIK1L est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDIK1 L antibody was raised against the middle region of PDIK1
- Purification
- Affinity purified
- Immunogène
- PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH
- Top Product
- Discover our top product PDIK1L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDIK1L Blocking Peptide, catalog no. 33R-2870, is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))
- Autre désignation
- PDIK1L (PDIK1L Produits)
- Synonymes
- anticorps CLIK1L, anticorps STK35L2, anticorps BC027088, anticorps stk35l2, anticorps RGD1307476, anticorps Stk35l2, anticorps pdik1-a, anticorps pdik1l, anticorps pdik1-b, anticorps MGC81117, anticorps wu:fc95a02, anticorps zgc:123209, anticorps LOC100224737, anticorps PDLIM1 interacting kinase 1 like, anticorps PDLIM1 interacting kinase 1 like S homeolog, anticorps PDLIM1 interacting kinase 1 like L homeolog, anticorps PDIK1L, anticorps Pdik1l, anticorps pdik1l.S, anticorps pdik1l.L, anticorps pdik1l
- Sujet
- The specific function of PDIK1L is not yet known.
- Poids moléculaire
- 38 kDa (MW of target protein)
-