C22orf25 anticorps (N-Term)

N° du produit ABIN632752

Détail du produit anti-C22orf25 anticorps

Antigène: C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C22orf25 est non-conjugé

Application: Western Blotting (WB)

Specificité: C22 ORF25 antibody was raised against the N terminal Of C22 rf25

Purification: Affinity purified

Immunogène: C22 ORF25 antibody was raised using the N terminal Of C22 rf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C22ORF25 Blocking Peptide, catalog no. 33R-5813, is also available for use as a blocking control in assays to test for specificity of this C22ORF25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C22orf25

Antigène: C22orf25 (Chromosome 22 Open Reading Frame 25 (C22orf25))

Autre désignation: C22ORF25 (C22orf25 Produits)

Synonymes: anticorps c22orf25, anticorps MGC88919, anticorps C22orf25, anticorps TANGO2, anticorps C17H22orf25, anticorps transport and golgi organization 2 homolog L homeolog, anticorps transport and golgi organization 2 homolog, anticorps transport and golgi organization 2 homolog (Drosophila), anticorps tango2.L, anticorps tango2, anticorps TANGO2

Sujet: The function of C22orf25 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 31 kDa (MW of target protein)