BEND2 anticorps (Middle Region)
-
- Antigène Voir toutes BEND2 Anticorps
- BEND2 (BEN Domain Containing 2 (BEND2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BEND2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CXORF20 antibody was raised against the middle region of Cxorf20
- Purification
- Affinity purified
- Immunogène
- CXORF20 antibody was raised using the middle region of Cxorf20 corresponding to a region with amino acids DGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAW
- Top Product
- Discover our top product BEND2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CXORF20 Blocking Peptide, catalog no. 33R-1949, is also available for use as a blocking control in assays to test for specificity of this CXORF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BEND2 (BEN Domain Containing 2 (BEND2))
- Autre désignation
- CXORF20 (BEND2 Produits)
- Synonymes
- anticorps CXorf20, anticorps BEN domain containing 2, anticorps BEND2
- Sujet
- The function of CXorf20 has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 88 kDa (MW of target protein)
-