TBC1D21 anticorps (N-Term)

N° du produit ABIN632761

Détail du produit anti-TBC1D21 anticorps

Antigène: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D21 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D21 antibody was raised against the N terminal of TBC1 21

Purification: Affinity purified

Immunogène: TBC1 D21 antibody was raised using the N terminal of TBC1 21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D21 Blocking Peptide, catalog no. 33R-6568, is also available for use as a blocking control in assays to test for specificity of this TBC1D21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D21

Antigène: TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))

Autre désignation: TBC1D21 (TBC1D21 Produits)

Synonymes: anticorps 1700095K08Rik, anticorps MgcRabGAP, anticorps RGD1310243, anticorps TBC1 domain family, member 21, anticorps TBC1 domain family member 21, anticorps Tbc1d21, anticorps TBC1D21

Sujet: TBC1D21 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 39 kDa (MW of target protein)