TBC1D21 anticorps (N-Term)
-
- Antigène Voir toutes TBC1D21 Anticorps
- TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TBC1D21 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TBC1 D21 antibody was raised against the N terminal of TBC1 21
- Purification
- Affinity purified
- Immunogène
- TBC1 D21 antibody was raised using the N terminal of TBC1 21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC
- Top Product
- Discover our top product TBC1D21 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TBC1D21 Blocking Peptide, catalog no. 33R-6568, is also available for use as a blocking control in assays to test for specificity of this TBC1D21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TBC1D21 (TBC1 Domain Family, Member 21 (TBC1D21))
- Autre désignation
- TBC1D21 (TBC1D21 Produits)
- Synonymes
- anticorps 1700095K08Rik, anticorps MgcRabGAP, anticorps RGD1310243, anticorps TBC1 domain family, member 21, anticorps TBC1 domain family member 21, anticorps Tbc1d21, anticorps TBC1D21
- Sujet
- TBC1D21 may act as a GTPase-activating protein for Rab family proteins.
- Poids moléculaire
- 39 kDa (MW of target protein)
-