FAM71A anticorps (C-Term)
-
- Antigène Tous les produits FAM71A
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM71A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM71 A antibody was raised against the C terminal of FAM71
- Purification
- Affinity purified
- Immunogène
- FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))
- Autre désignation
- FAM71A (FAM71A Produits)
- Synonymes
- anticorps RGD1561646, anticorps GARI-L4, anticorps 4933417M04Rik, anticorps RP11-338C15.4, anticorps family with sequence similarity 71, member A, anticorps family with sequence similarity 71 member A, anticorps Fam71a, anticorps FAM71A
- Sujet
- FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.
- Poids moléculaire
- 63 kDa (MW of target protein)
-