C5orf35 anticorps (N-Term)

N° du produit ABIN632765

Détail du produit anti-C5orf35 anticorps

Antigène: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C5orf35 est non-conjugé

Application: Western Blotting (WB)

Specificité: C5 ORF35 antibody was raised against the N terminal Of C5 rf35

Purification: Affinity purified

Immunogène: C5 ORF35 antibody was raised using the N terminal Of C5 rf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF35 Blocking Peptide, catalog no. 33R-7722, is also available for use as a blocking control in assays to test for specificity of this C5ORF35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C5orf35

Antigène: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Autre désignation: C5ORF35 (C5orf35 Produits)

Synonymes: anticorps DKFZp468C1120, anticorps C5orf35, anticorps SET domain containing 9, anticorps SETD9, anticorps setd9

Sujet: The function of C5orf35 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)