NR2C2AP anticorps (N-Term)

N° du produit ABIN632770

Détail du produit anti-NR2C2AP anticorps

Antigène: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR2C2AP est non-conjugé

Application: Western Blotting (WB)

Specificité: TRA16 antibody was raised against the N terminal Of Tra16

Purification: Affinity purified

Immunogène: TRA16 antibody was raised using the N terminal Of Tra16 corresponding to a region with amino acids THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRA16 Blocking Peptide, catalog no. 33R-9109, is also available for use as a blocking control in assays to test for specificity of this TRA16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRA16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR2C2AP

Antigène: NR2C2AP (Nuclear Receptor 2C2-Associated Protein (NR2C2AP))

Autre désignation: TRA16 (NR2C2AP Produits)

Synonymes: anticorps tra16, anticorps NR2C2AP, anticorps TRA16, anticorps 2310073E15Rik, anticorps si:ch211-125m10.4, anticorps zgc:136330, anticorps nuclear receptor 2C2-associated protein, anticorps nuclear receptor 2C2 associated protein, anticorps nuclear receptor 2C2-associated protein S homeolog, anticorps nr2c2ap, anticorps NR2C2AP, anticorps Nr2c2ap, anticorps nr2c2ap.S

Sujet: TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway