CCDC60 anticorps (C-Term)

N° du produit ABIN632771

Détail du produit anti-CCDC60 anticorps

Antigène: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Épitope: C-Term

Reactivité: Rat, Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC60 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC60 antibody was raised against the C terminal of CCDC60

Purification: Affinity purified

Immunogène: CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC60 Blocking Peptide, catalog no. 33R-8088, is also available for use as a blocking control in assays to test for specificity of this CCDC60 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC60

Antigène: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Autre désignation: CCDC60 (CCDC60 Produits)

Synonymes: anticorps AU018954, anticorps C130098D09, anticorps coiled-coil domain containing 60, anticorps transmembrane protein 233, anticorps CCDC60, anticorps TMEM233, anticorps Ccdc60

Sujet: The function of CCDC60 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 63 kDa (MW of target protein)