PRELID2 anticorps (C-Term)

N° du produit ABIN632775

Détail du produit anti-PRELID2 anticorps

Antigène: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRELID2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRELID2 antibody was raised against the C terminal of PRELID2

Purification: Affinity purified

Immunogène: PRELID2 antibody was raised using the C terminal of PRELID2 corresponding to a region with amino acids GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRELID2 Blocking Peptide, catalog no. 33R-3533, is also available for use as a blocking control in assays to test for specificity of this PRELID2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRELID2

Antigène: PRELID2 (PRELI Domain Containing 2 (PRELID2))

Autre désignation: PRELID2 (PRELID2 Produits)

Synonymes: anticorps 1700003A01Rik, anticorps C330008K14Rik, anticorps PRELID2, anticorps PRELI domain containing 2, anticorps PRELI domain containing 2 L homeolog, anticorps PRELID2, anticorps Prelid2, anticorps prelid2.L

Sujet: PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

Poids moléculaire: 22 kDa (MW of target protein)