FAM116A anticorps (Middle Region)

N° du produit ABIN632778

Détail du produit anti-FAM116A anticorps

Antigène: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM116A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM116 A antibody was raised against the middle region of FAM116

Purification: Affinity purified

Immunogène: FAM116 A antibody was raised using the middle region of FAM116 corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM116A Blocking Peptide, catalog no. 33R-4585, is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM116A

Antigène: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Autre désignation: FAM116A (FAM116A Produits)

Synonymes: anticorps AFI1A, anticorps FAM116A, anticorps A630054L15Rik, anticorps Fam116a, anticorps mFLJ00229, anticorps RGD1306064, anticorps fam116a, anticorps fam116aa, anticorps zgc:103543, anticorps DENN domain containing 6A, anticorps DENN/MADD domain containing 6A, anticorps DENN/MADD domain containing 6Aa, anticorps DENND6A, anticorps Dennd6a, anticorps dennd6aa

Sujet: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Poids moléculaire: 67 kDa (MW of target protein)