MAGEA4 anticorps (C-Term)

N° du produit ABIN632780

Détail du produit anti-MAGEA4 anticorps

Antigène: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEA4 antibody was raised against the C terminal of MAGEA4

Purification: Affinity purified

Immunogène: MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA4 Blocking Peptide, catalog no. 33R-2620, is also available for use as a blocking control in assays to test for specificity of this MAGEA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA4

Antigène: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Autre désignation: MAGEA4 (MAGEA4 Produits)

Synonymes: anticorps Mage-a4, anticorps MAGEA4, anticorps CT1.4, anticorps MAGE-41, anticorps MAGE-X2, anticorps MAGE4, anticorps MAGE4A, anticorps MAGE4B, anticorps melanoma antigen, family A, 4, anticorps MAGE family member A4, anticorps Magea4, anticorps MAGEA4

Sujet: MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Poids moléculaire: 35 kDa (MW of target protein)