SOHLH1 anticorps (C-Term)

N° du produit ABIN632790

Détail du produit anti-SOHLH1 anticorps

Antigène: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOHLH1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SOHLH1 antibody was raised against the C terminal of SOHLH1

Purification: Affinity purified

Immunogène: SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SOHLH1 Blocking Peptide, catalog no. 33R-6990, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOHLH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SOHLH1

Antigène: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Autre désignation: SOHLH1 (SOHLH1 Produits)

Synonymes: anticorps C9orf157, anticorps NOHLH, anticorps SPATA27, anticorps TEB2, anticorps bA100C15.3, anticorps bHLHe80, anticorps Gm110, anticorps Nohlh, anticorps RGD1564440, anticorps spermatogenesis and oogenesis specific basic helix-loop-helix 1, anticorps SOHLH1, anticorps Sohlh1

Sujet: SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Poids moléculaire: 41 kDa (MW of target protein)