CHORDC1 anticorps
-
- Antigène Voir toutes CHORDC1 Anticorps
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHORDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
- Top Product
- Discover our top product CHORDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHORDC1 Blocking Peptide, catalog no. 33R-8501, is also available for use as a blocking control in assays to test for specificity of this CHORDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHORDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
- Autre désignation
- CHORDC1 (CHORDC1 Produits)
- Synonymes
- anticorps CHP1, anticorps CHP-1, anticorps MGC89160, anticorps NV16801, anticorps Chp-1, anticorps Morgana, anticorps 1110001O09Rik, anticorps AA409036, anticorps morgana, anticorps zgc:63894, anticorps cysteine and histidine rich domain containing 1, anticorps cysteine and histidine-rich domain-containing protein, anticorps cysteine and histidine rich domain containing 1 S homeolog, anticorps cysteine and histidine-rich domain (CHORD)-containing 1, anticorps cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1, anticorps cysteine and histidine-rich domain (CHORD) containing 1b, anticorps CHORDC1, anticorps Chordc1, anticorps LOC412067, anticorps chordc1.S, anticorps chordc1, anticorps chordc1b
- Sujet
- CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.
- Poids moléculaire
- 37 kDa (MW of target protein)
-