PHLDA3 anticorps (N-Term)
-
- Antigène Voir toutes PHLDA3 Anticorps
- PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PHLDA3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PHLDA3 antibody was raised against the N terminal of PHLDA3
- Purification
- Affinity purified
- Immunogène
- PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC
- Top Product
- Discover our top product PHLDA3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PHLDA3 Blocking Peptide, catalog no. 33R-5324, is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))
- Autre désignation
- PHLDA3 (PHLDA3 Produits)
- Synonymes
- anticorps TIH1, anticorps Tih1, anticorps si:dz182n13.5, anticorps zgc:92333, anticorps pleckstrin homology like domain family A member 3, anticorps pleckstrin homology like domain, family A, member 3, anticorps pleckstrin homology-like domain, family A, member 3, anticorps PHLDA3, anticorps Phlda3, anticorps phlda3
- Sujet
- PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.
- Poids moléculaire
- 14 kDa (MW of target protein)
-