R3HDM2 anticorps (Middle Region)
-
- Antigène Tous les produits R3HDM2
- R3HDM2 (R3H Domain Containing 2 (R3HDM2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp R3HDM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- R3 HDM2 antibody was raised against the middle region of R3 DM2
- Purification
- Affinity purified
- Immunogène
- R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
R3HDM2 Blocking Peptide, catalog no. 33R-7740, is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- R3HDM2 (R3H Domain Containing 2 (R3HDM2))
- Autre désignation
- R3HDM2 (R3HDM2 Produits)
- Synonymes
- anticorps PR01365, anticorps 1300003K24Rik, anticorps AU041262, anticorps mKIAA1002, anticorps RGD1310066, anticorps R3H domain containing 2, anticorps R3HDM2, anticorps R3hdm2
- Sujet
- R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.
- Poids moléculaire
- 68 kDa (MW of target protein)
-