PDXDC1 anticorps (N-Term)

N° du produit ABIN632806

Détail du produit anti-PDXDC1 anticorps

Antigène: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDXDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDXDC1 antibody was raised against the N terminal of PDXDC1

Purification: Affinity purified

Immunogène: PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDXDC1 Blocking Peptide, catalog no. 33R-1893, is also available for use as a blocking control in assays to test for specificity of this PDXDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDXDC1

Antigène: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Autre désignation: PDXDC1 (PDXDC1 Produits)

Synonymes: anticorps 2210010A19Rik, anticorps AA415817, anticorps Kiaa0251-hp, anticorps RGD1562597, anticorps LP8165, anticorps pdxdc1, anticorps wu:fj29c10, anticorps zgc:92179, anticorps pyridoxal-dependent decarboxylase domain containing 1, anticorps pyridoxal dependent decarboxylase domain containing 1, anticorps pyridoxal-dependent decarboxylase domain containing 1 L homeolog, anticorps Pdxdc1, anticorps PDXDC1, anticorps pdxdc1.L, anticorps pdxdc1

Sujet: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Poids moléculaire: 87 kDa (MW of target protein)