AKD1 anticorps (N-Term)

N° du produit ABIN632823

Détail du produit anti-AKD1 anticorps

Antigène: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C6 ORF199 antibody was raised against the N terminal Of C6 rf199

Purification: Affinity purified

Immunogène: C6 ORF199 antibody was raised using the N terminal Of C6 rf199 corresponding to a region with amino acids TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF199 Blocking Peptide, catalog no. 33R-9292, is also available for use as a blocking control in assays to test for specificity of this C6ORF199 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF199 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKD1

Antigène: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Autre désignation: C6ORF199 (ADK1 Produits)

Sujet: The function of the C6orf199 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 48 kDa (MW of target protein)