C4orf22 anticorps (N-Term)

N° du produit ABIN632825

Détail du produit anti-C4orf22 anticorps

Antigène: C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4orf22 est non-conjugé

Application: Western Blotting (WB)

Specificité: C4 ORF22 antibody was raised against the N terminal Of C4 rf22

Purification: Affinity purified

Immunogène: C4 ORF22 antibody was raised using the N terminal Of C4 rf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4ORF22 Blocking Peptide, catalog no. 33R-10163, is also available for use as a blocking control in assays to test for specificity of this C4ORF22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4orf22

Antigène: C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))

Autre désignation: C4ORF22 (C4orf22 Produits)

Synonymes: anticorps chromosome 4 open reading frame 22, anticorps C4orf22

Sujet: The specific function of C4orf22 is not yet known.

Poids moléculaire: 27 kDa (MW of target protein)