PXT1 anticorps (Middle Region)

N° du produit ABIN632826

Détail du produit anti-PXT1 anticorps

Antigène: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PXT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PXT1 antibody was raised against the middle region of PXT1

Purification: Affinity purified

Immunogène: PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PXT1 Blocking Peptide, catalog no. 33R-6334, is also available for use as a blocking control in assays to test for specificity of this PXT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PXT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PXT1

Antigène: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Autre désignation: PXT1 (PXT1 Produits)

Synonymes: anticorps STEPP, anticorps 1700001G18Rik, anticorps Stepp, anticorps peroxisomal, testis specific 1, anticorps PXT1, anticorps Pxt1

Sujet: The function of PXT1 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 6 kDa (MW of target protein)