FAM98B anticorps (N-Term)

N° du produit ABIN632834

Détail du produit anti-FAM98B anticorps

Antigène: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM98B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM98 B antibody was raised against the N terminal of FAM98

Purification: Affinity purified

Immunogène: FAM98 B antibody was raised using the N terminal of FAM98 corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM98B Blocking Peptide, catalog no. 33R-5475, is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM98B

Antigène: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Autre désignation: FAM98B (FAM98B Produits)

Synonymes: anticorps 2610510H03Rik, anticorps RGD1564603, anticorps family with sequence similarity 98 member B, anticorps family with sequence similarity 98, member B, anticorps FAM98B, anticorps Fam98b

Sujet: The specific function of FAM98B is not yet known.

Poids moléculaire: 45 kDa (MW of target protein)