GANC anticorps (Middle Region)
-
- Antigène Voir toutes GANC Anticorps
- GANC (Glucosidase, Alpha, Neutral C (GANC))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GANC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GANC antibody was raised against the middle region of GANC
- Purification
- Affinity purified
- Immunogène
- GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR
- Top Product
- Discover our top product GANC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GANC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GANC (Glucosidase, Alpha, Neutral C (GANC))
- Autre désignation
- GANC (GANC Produits)
- Synonymes
- anticorps 5830445O15Rik, anticorps 9330160A12, anticorps mFLJ00088, anticorps glucosidase alpha, neutral C, anticorps calpain-3, anticorps glucosidase, alpha; neutral C, anticorps GANC, anticorps LOC453361, anticorps ganc, anticorps Ganc
- Sujet
- GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.
- Poids moléculaire
- 104 kDa (MW of target protein)
-