C3orf62 anticorps (Middle Region)

N° du produit ABIN632849

Détail du produit anti-C3orf62 anticorps

Antigène: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Épitope: Middle Region

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C3orf62 est non-conjugé

Application: Western Blotting (WB)

Specificité: C3 ORF62 antibody was raised against the middle region of C3 rf62

Purification: Affinity purified

Immunogène: C3 ORF62 antibody was raised using the middle region of C3 rf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C3orf62

Antigène: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Autre désignation: C3ORF62 (C3orf62 Produits)

Synonymes: anticorps chromosome 3 open reading frame 62, anticorps C3orf62

Sujet: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)