IER5L anticorps (Middle Region)

N° du produit ABIN632857

Détail du produit anti-IER5L anticorps

Antigène: IER5L (Immediate Early Response 5-Like (IER5L))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IER5L est non-conjugé

Application: Western Blotting (WB)

Specificité: IER5 L antibody was raised against the middle region of IER5

Purification: Affinity purified

Immunogène: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IER5L Blocking Peptide, catalog no. 33R-8655, is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IER5L

Antigène: IER5L (Immediate Early Response 5-Like (IER5L))

Autre désignation: IER5L (IER5L Produits)

Synonymes: anticorps 2610524G09Rik, anticorps fe50b07, anticorps zgc:73321, anticorps zgc:77455, anticorps wu:fe50b07, anticorps bA247A12.2, anticorps MGC75980, anticorps immediate early response 5-like, anticorps immediate early response 5 like, anticorps immediate early response 5-like S homeolog, anticorps immediate early response 2, anticorps Ier5l, anticorps ier5l, anticorps IER5L, anticorps ier5l.S, anticorps IER2

Sujet: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)