Chromosome 1 Open Reading Frame 190 (C1orf190) (Middle Region) anticorps

N° du produit ABIN632875

Détail du produit

Antigène: Chromosome 1 Open Reading Frame 190 (C1orf190)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: C1 ORF190 antibody was raised against the middle region of C1 rf190

Purification: Affinity purified

Immunogène: C1 ORF190 antibody was raised using the middle region of C1 rf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF190 Blocking Peptide, catalog no. 33R-8527, is also available for use as a blocking control in assays to test for specificity of this C1ORF190 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF190 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Chromosome 1 Open Reading Frame 190 (C1orf190)

Autre désignation: C1ORF190 (C1orf190 Produits)

Synonymes: anticorps C8H1orf190, anticorps C1orf190, anticorps LRAP35a, anticorps LRP35A, anticorps Lrp35a, anticorps RGD1566001, anticorps 1520402A15Rik, anticorps leucine rich adaptor protein 1, anticorps LURAP1, anticorps lurap1, anticorps Lurap1

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 26 kDa (MW of target protein)