PBLD1 anticorps (N-Term)

N° du produit ABIN632880

Détail du produit anti-PBLD1 anticorps

Antigène: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PBLD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PBLD antibody was raised against the N terminal of PBLD

Purification: Affinity purified

Immunogène: PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PBLD Blocking Peptide, catalog no. 33R-4526, is also available for use as a blocking control in assays to test for specificity of this PBLD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PBLD1

Antigène: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Autre désignation: PBLD (PBLD1 Produits)

Synonymes: anticorps MAWBP, anticorps MAWDBP, anticorps 0610038K03Rik, anticorps Mawbp, anticorps Pbld, anticorps phenazine biosynthesis like protein domain containing, anticorps phenazine biosynthesis-like protein domain containing 1, anticorps PBLD, anticorps Pbld1

Sujet: The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 31 kDa (MW of target protein)