RALGDS anticorps (N-Term)

N° du produit ABIN632886

Détail du produit anti-RALGDS anticorps

Antigène: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RALGDS est non-conjugé

Application: Western Blotting (WB)

Specificité: RALGDS antibody was raised against the N terminal of RALGDS

Purification: Affinity purified

Immunogène: RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RALGDS Blocking Peptide, catalog no. 33R-4641, is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RALGDS

Antigène: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Autre désignation: RALGDS (RALGDS Produits)

Synonymes: anticorps RGDS, anticorps RGF, anticorps RalGEF, anticorps Gnds, anticorps Rgds, anticorps mKIAA1308, anticorps RALGDS, anticorps ral guanine nucleotide dissociation stimulator, anticorps RALGDS, anticorps Ralgds, anticorps ralgds

Sujet: The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 95 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway