RALGDS anticorps (N-Term)
-
- Antigène Voir toutes RALGDS Anticorps
- RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RALGDS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RALGDS antibody was raised against the N terminal of RALGDS
- Purification
- Affinity purified
- Immunogène
- RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED
- Top Product
- Discover our top product RALGDS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RALGDS Blocking Peptide, catalog no. 33R-4641, is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))
- Autre désignation
- RALGDS (RALGDS Produits)
- Synonymes
- anticorps RGDS, anticorps RGF, anticorps RalGEF, anticorps Gnds, anticorps Rgds, anticorps mKIAA1308, anticorps RALGDS, anticorps ral guanine nucleotide dissociation stimulator, anticorps RALGDS, anticorps Ralgds, anticorps ralgds
- Sujet
- The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 95 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-