PSMA5 anticorps

N° du produit ABIN632898

Détail du produit anti-PSMA5 anticorps

Antigène: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA5 Blocking Peptide, catalog no. 33R-5998, is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA5

Antigène: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Autre désignation: PSMA5 (PSMA5 Produits)

Synonymes: anticorps 154644_at, anticorps Alpha-5, anticorps CG10938, anticorps Dmel\\CG10938, anticorps PRCZ, anticorps PSA5_DROME, anticorps PSMA5, anticorps ProsMA5, anticorps alpha5, anticorps alpha5_dm, anticorps prosMA5, anticorps DDBDRAFT_0216562, anticorps DDBDRAFT_0232930, anticorps DDB_0216562, anticorps DDB_0232930, anticorps ZETA, anticorps PSC5, anticorps zgc:86851, anticorps Proteasome alpha5 subunit, anticorps proteasome subunit alpha type 5, putative, anticorps proteasome subunit alpha type 5, anticorps 20S proteasome subunit alpha-5, anticorps proteasome (prosome, macropain) subunit, alpha type 5, anticorps proteasome subunit alpha 5, anticorps proteasome subunit alpha 5 S homeolog, anticorps proteasome (prosome, macropain) subunit, alpha type, 5, anticorps Prosalpha5, anticorps PF07_0112, anticorps CNH01360, anticorps cgd5_1820, anticorps PSA5, anticorps psmA5, anticorps NAEGRDRAFT_55551, anticorps LOC100282220, anticorps LOC100283546, anticorps Psma5, anticorps PSMA5, anticorps psma5.S, anticorps psma5

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA