PSPH anticorps (Middle Region)
-
- Antigène Voir toutes PSPH Anticorps
- PSPH (Phosphoserine Phosphatase (PSPH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSPH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PSPH antibody was raised against the middle region of PSPH
- Purification
- Affinity purified
- Immunogène
- PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
- Top Product
- Discover our top product PSPH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSPH Blocking Peptide, catalog no. 33R-4067, is also available for use as a blocking control in assays to test for specificity of this PSPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSPH (Phosphoserine Phosphatase (PSPH))
- Autre désignation
- PSPH (PSPH Produits)
- Synonymes
- anticorps PSP, anticorps PSPHD, anticorps AI480570, anticorps PSPase, anticorps PSPH, anticorps psph, anticorps MGC78828, anticorps zgc:112414, anticorps DDBDRAFT_0183847, anticorps DDBDRAFT_0230054, anticorps DDB_0183847, anticorps DDB_0230054, anticorps phosphoserine phosphatase, anticorps phosphoserine phosphatase L homeolog, anticorps PSP; O-phosphoserine phosphohydrolase; PSPase, anticorps phosphoserine phosphatase SerB, anticorps BPI fold containing family A member 2, anticorps PSPH, anticorps Psph, anticorps psph.L, anticorps psph, anticorps serB, anticorps serB-1, anticorps LOC5568588, anticorps PSP, anticorps Svir_29300, anticorps MMAH_RS03435, anticorps BPIFA2
- Sujet
- The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- L'effet Warburg
-