MFAP1 anticorps (Middle Region)

N° du produit ABIN632905

Détail du produit anti-MFAP1 anticorps

Antigène: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MFAP1 antibody was raised against the middle region of MFAP1

Purification: Affinity purified

Immunogène: MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFAP1 Blocking Peptide, catalog no. 33R-9156, is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFAP1

Antigène: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Autre désignation: MFAP1 (MFAP1 Produits)

Synonymes: anticorps AMF, anticorps zgc:56551, anticorps mfap1, anticorps microfibril associated protein 1, anticorps microfibrillar associated protein 1, anticorps microfibril associated protein 1 L homeolog, anticorps MFAP1, anticorps Mfap1, anticorps mfap1, anticorps mfap1.L

Sujet: MFAP1 is a component of the elastin-associated microfibrils.

Poids moléculaire: 52 kDa (MW of target protein)