C22orf28 anticorps (N-Term)

N° du produit ABIN632911

Détail du produit anti-C22orf28 anticorps

Antigène: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C22orf28 est non-conjugé

Application: Western Blotting (WB)

Specificité: C22 ORF28 antibody was raised against the N terminal Of C22 rf28

Purification: Affinity purified

Immunogène: C22 ORF28 antibody was raised using the N terminal Of C22 rf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C22ORF28 Blocking Peptide, catalog no. 33R-7033, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C22orf28

Antigène: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Autre désignation: C22ORF28 (C22orf28 Produits)

Synonymes: anticorps C1H22orf28, anticorps C22orf28, anticorps DJ149A16.6, anticorps FAAP, anticorps RP1-149A16.6, anticorps c22orf28, anticorps C10H22orf28, anticorps MGC154502, anticorps HSPC117, anticorps AI255213, anticorps AI463255, anticorps RNA 2',3'-cyclic phosphate and 5'-OH ligase, anticorps tRNA-splicing ligase RtcB homolog, anticorps RTCB, anticorps rtcb, anticorps rtcb.L, anticorps Rtcb

Sujet: C22ORF28 is believed to be involved in vinculin binding.

Poids moléculaire: 55 kDa (MW of target protein)