MED31 anticorps (N-Term)

N° du produit ABIN632918

Détail du produit anti-MED31 anticorps

Antigène: MED31 (Mediator Complex Subunit 31 (MED31))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MED31 est non-conjugé

Application: Western Blotting (WB)

Specificité: MED31 antibody was raised against the N terminal of MED31

Purification: Affinity purified

Immunogène: MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MED31 Blocking Peptide, catalog no. 33R-5587, is also available for use as a blocking control in assays to test for specificity of this MED31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MED31

Antigène: MED31 (Mediator Complex Subunit 31 (MED31))

Autre désignation: MED31 (MED31 Produits)

Synonymes: anticorps 3110004H13Rik, anticorps Soh1, anticorps CGI-125, anticorps l11Jus15, anticorps RGD1309457, anticorps fa04d01, anticorps zgc:92673, anticorps wu:fa04d01, anticorps CaO19.1429, anticorps cgi-125, anticorps med31, anticorps med31-a, anticorps med31-b, anticorps med31a, anticorps soh1, anticorps soh1-A, anticorps mediator complex subunit 31, anticorps Soh1p, anticorps mediator complex subunit Med31, anticorps mediator complex subunit 31 L homeolog, anticorps MED31, anticorps Med31, anticorps med31, anticorps SOH1, anticorps med31.L

Sujet: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha