RWDD1 anticorps (Middle Region)
-
- Antigène Voir toutes RWDD1 Anticorps
- RWDD1 (RWD Domain Containing 1 (RWDD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RWDD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RWDD1 antibody was raised against the middle region of RWDD1
- Purification
- Affinity purified
- Immunogène
- RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ
- Top Product
- Discover our top product RWDD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RWDD1 Blocking Peptide, catalog no. 33R-4491, is also available for use as a blocking control in assays to test for specificity of this RWDD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RWDD1 (RWD Domain Containing 1 (RWDD1))
- Autre désignation
- RWDD1 (RWDD1 Produits)
- Synonymes
- anticorps PTD013, anticorps 0710001K08Rik, anticorps 2610002D06Rik, anticorps 2700069A07Rik, anticorps IH1, anticorps sarip, anticorps RWD domain containing 1, anticorps RWDD1, anticorps Rwdd1
- Sujet
- The RWDD1 protein protects DRG2 from proteolytic degradation.
- Poids moléculaire
- 17 kDa (MW of target protein)
-