C20orf111 anticorps (N-Term)

N° du produit ABIN632921

Détail du produit anti-C20orf111 anticorps

Antigène: C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))

Épitope: N-Term

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C20orf111 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF111 antibody was raised against the N terminal Of C20 rf111

Purification: Affinity purified

Immunogène: C20 ORF111 antibody was raised using the N terminal Of C20 rf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF111 Blocking Peptide, catalog no. 33R-7916, is also available for use as a blocking control in assays to test for specificity of this C20ORF111 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF111 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C20orf111

Antigène: C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))

Autre désignation: C20ORF111 (C20orf111 Produits)

Synonymes: anticorps MGC76290, anticorps DKFZp468B2423, anticorps C20orf111, anticorps MGC134505, anticorps c20orf111, anticorps HSPC207, anticorps Osr1, anticorps Perit1, anticorps dJ1183I21.1, anticorps oxidative stress responsive serine-rich 1, anticorps oxidative stress responsive serine rich 1, anticorps oxidative stress responsive serine-rich 1 L homeolog, anticorps oser1, anticorps OSER1, anticorps oser1.L

Sujet: The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)