CNOT11 anticorps (N-Term)

N° du produit ABIN632925

Détail du produit anti-CNOT11 anticorps

Antigène: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNOT11 est non-conjugé

Application: Western Blotting (WB)

Specificité: C2 ORF29 antibody was raised against the N terminal Of C2 rf29

Purification: Affinity purified

Immunogène: C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF29 Blocking Peptide, catalog no. 33R-6815, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNOT11

Antigène: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Autre désignation: C2ORF29 (CNOT11 Produits)

Synonymes: anticorps C2orf29, anticorps 2410015L18Rik, anticorps C40, anticorps D1Bwg0212e, anticorps RGD1560909, anticorps fj49e01, anticorps wu:fj49e01, anticorps zgc:163002, anticorps CCR4-NOT transcription complex subunit 11, anticorps CCR4-NOT transcription complex, subunit 11, anticorps CNOT11, anticorps Cnot11, anticorps cnot11

Sujet: The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 55 kDa (MW of target protein)