CHCHD3 anticorps (N-Term)
-
- Antigène Voir toutes CHCHD3 Anticorps
- CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHCHD3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHCHD3 antibody was raised against the N terminal of CHCHD3
- Purification
- Affinity purified
- Immunogène
- CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR
- Top Product
- Discover our top product CHCHD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHCHD3 Blocking Peptide, catalog no. 33R-8063, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))
- Autre désignation
- CHCHD3 (CHCHD3 Produits)
- Sujet
- ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.
- Poids moléculaire
- 26 kDa (MW of target protein)
-