RMND1 anticorps

N° du produit ABIN632930

Détail du produit anti-RMND1 anticorps

Antigène: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RMND1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RMND1 Blocking Peptide, catalog no. 33R-4909, is also available for use as a blocking control in assays to test for specificity of this RMND1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RMND1

Antigène: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Autre désignation: RMND1 (RMND1 Produits)

Synonymes: anticorps zgc:113022, anticorps DKFZp469I1433, anticorps C6orf96, anticorps COXPD11, anticorps RMD1, anticorps bA351K16, anticorps bA351K16.3, anticorps 0610042C05Rik, anticorps AA408137, anticorps AI462664, anticorps AW536662, anticorps Iag-1, anticorps RGD1309546, anticorps required for meiotic nuclear division 1 homolog, anticorps RMND1, anticorps rmnd1, anticorps Rmnd1

Sujet: The function of RMND1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)