SLFN12 anticorps (N-Term)

N° du produit ABIN632933

Détail du produit anti-SLFN12 anticorps

Antigène: SLFN12 (Schlafen Family Member 12 (SLFN12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLFN12 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLFN12 antibody was raised against the N terminal of SLFN12

Purification: Affinity purified

Immunogène: SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLFN12 Blocking Peptide, catalog no. 33R-4534, is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLFN12

Antigène: SLFN12 (Schlafen Family Member 12 (SLFN12))

Autre désignation: SLFN12 (SLFN12 Produits)

Synonymes: anticorps SLFN3, anticorps SLFN12L, anticorps schlafen family member 12, anticorps SLFN12

Sujet: The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 67 kDa (MW of target protein)