FAM90A1 anticorps (N-Term)

N° du produit ABIN632936

Détail du produit anti-FAM90A1 anticorps

Antigène: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM90A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM90 A1 antibody was raised against the N terminal of FAM90 1

Purification: Affinity purified

Immunogène: FAM90 A1 antibody was raised using the N terminal of FAM90 1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM90A1 Blocking Peptide, catalog no. 33R-7006, is also available for use as a blocking control in assays to test for specificity of this FAM90A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM90A1

Antigène: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Autre désignation: FAM90A1 (FAM90A1 Produits)

Synonymes: anticorps family with sequence similarity 90 member A1, anticorps FAM90A1

Sujet: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements.

Poids moléculaire: 50 kDa (MW of target protein)