SMG8 anticorps (Middle Region)
-
- Antigène Voir toutes SMG8 Anticorps
- SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMG8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C17 ORF71 antibody was raised against the middle region of C17 rf71
- Purification
- Affinity purified
- Immunogène
- C17 ORF71 antibody was raised using the middle region of C17 rf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
- Top Product
- Discover our top product SMG8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C17ORF71 Blocking Peptide, catalog no. 33R-3702, is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF71 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))
- Autre désignation
- C17ORF71 (SMG8 Produits)
- Synonymes
- anticorps C17orf71, anticorps 1200011M11Rik, anticorps C19H17orf71, anticorps SMG8, nonsense mediated mRNA decay factor, anticorps smg-8 homolog, nonsense mediated mRNA decay factor (C. elegans), anticorps Protein smg-8, anticorps SMG8, anticorps Smg8, anticorps smg-8
- Sujet
- The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).
- Poids moléculaire
- 110 kDa (MW of target protein)
-