ARHGAP15 anticorps (Middle Region)

N° du produit ABIN632948

Détail du produit anti-ARHGAP15 anticorps

Antigène: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGAP15 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Purification: Affinity purified

Immunogène: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGAP15

Antigène: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Autre désignation: ARHGAP15 (ARHGAP15 Produits)

Synonymes: anticorps pp905, anticorps sh3d20, anticorps sh3p20, anticorps camgap1, anticorps BM046, anticorps 5830480G12Rik, anticorps Rho GTPase activating protein 15, anticorps Rho GTPase activating protein 27, anticorps ARHGAP15, anticorps arhgap27, anticorps Arhgap15

Sujet: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Poids moléculaire: 54 kDa (MW of target protein)