MAGEB1 anticorps (Middle Region)

N° du produit ABIN632955

Détail du produit anti-MAGEB1 anticorps

Antigène: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEB1 antibody was raised against the middle region of MAGEB1

Purification: Affinity purified

Immunogène: MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEB1 Blocking Peptide, catalog no. 33R-2406, is also available for use as a blocking control in assays to test for specificity of this MAGEB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEB1

Antigène: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Autre désignation: MAGEB1 (MAGEB1 Produits)

Synonymes: anticorps CT3.1, anticorps DAM10, anticorps MAGE-Xp, anticorps MAGEL1, anticorps MAGEB1, anticorps Mage-b1, anticorps Mage-rs1, anticorps Magel1, anticorps Smage1, anticorps dam1, anticorps MAGE family member B1, anticorps melanoma-associated antigen B1, anticorps melanoma antigen, family B, 1, anticorps melanoma antigen family B, 1, anticorps MAGEB1, anticorps LOC491803, anticorps Mageb1

Sujet: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Poids moléculaire: 39 kDa (MW of target protein)